PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G096900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 97aa    MW: 10831.3 Da    PI: 8.7229
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G096900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB99.23.2e-3136923591
               NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                        ++ecvsefisfvtseasdkc++ekrkt+ngddllw  atlGfe+yv+plk+yl+ky 
  Brast08G096900.1.p 36 MKECVSEFISFVTSEASDKCHNEKRKTVNGDDLLWVTATLGFEKYVDPLKIYLHKYT 92
                        68******************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.2E-41736IPR009072Histone-fold
SuperFamilySSF471131.51E-222392IPR009072Histone-fold
PfamPF008083.7E-123571IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-193654No hitNo description
Gene3DG3DSA:1.10.20.102.4E-263793IPR009072Histone-fold
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-195573No hitNo description
PRINTSPR006152.2E-197492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MADGGSHDNG RPKGGGGGVV REQDRFLRIA NISRIMKECV SEFISFVTSE ASDKCHNEKR  60
KTVNGDDLLW VTATLGFEKY VDPLKIYLHK YTNKWP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-302191391NF-YB
4awl_B1e-302191492NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-302191492NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3766721e-48AK376672.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3131D13.
GenBankBT0093931e-48BT009393.1 Triticum aestivum clone wlm96.pk037.k9:fis, full insert mRNA sequence.
GenBankGU9027881e-48GU902788.1 Triticum monococcum nuclear transcription factor Y subunit B4 mRNA, partial cds.
GenBankJF7646011e-48JF764601.1 Hordeum vulgare NF-YB2 mRNA, complete cds.
GenBankKJ8622151e-48KJ862215.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B4 mRNA, complete cds.
GenBankKM0787411e-48KM078741.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564550.12e-45PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010232523.12e-45PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ5QMG32e-41NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2
TrEMBLI1HT462e-45I1HT46_BRADI; Uncharacterized protein
STRINGBRADI2G54200.17e-45(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.31e-39nuclear factor Y, subunit B8